You are viewing a plain text version of this content. The canonical link for it is here.
Posted to commits@tapestry.apache.org by bu...@apache.org on 2015/11/08 18:21:56 UTC
svn commit: r971770 [4/5] - in /websites/production/tapestry/content: ./
cache/
Modified: websites/production/tapestry/content/page-and-component-classes-faq.html
==============================================================================
--- websites/production/tapestry/content/page-and-component-classes-faq.html (original)
+++ websites/production/tapestry/content/page-and-component-classes-faq.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><h2 id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And Component Classes</h2><p>Main article: <a shape="rect" href="component-classes.html">Component Classes</a></p><h3 id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's the difference between a page and a component?</h3><p>There's very little difference between the two. Pages classes must be in the <em>root-package</em>.<code>pages</code> package; components must be in the <em>root-package</em>.<code>components</code>. Pages may provide event handlers for certain page-specific events (such as activate and passivate). Components may have parameters.</p><p>Other than that, they are more equal than they are different. They may have templates or may render themselves in code (pages usually have a template, components are more likely to render only in code).</p><p>The major difference is that Tapestry page templates may be stored in the web context directory, as
if they were static files (they can't be accessed from the client however; a specific rule prevents access to files with the <code>.tml</code> extension).</p><div class="confluence-information-macro confluence-information-macro-warning"><span class="aui-icon aui-icon-small aui-iconfont-error confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>It is possible that this feature may be removed in a later release. It is preferred that page templates be stored on the classpath, like component templates.</p></div></div><h3 id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How do I store my page classes in a different package?</h3><p>Tapestry is very rigid here; you can't. Page classes must go in <em>root-package</em>.<code>pages</code>, component classes in <em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to create sub-packages, to help organize your code better and more logically. For example, you
might have <em>root-package</em>.<code>pages.account.ViewAccount</code>, which would have the page name "account/viewaccount". (<span style="line-height: 1.4285715;">Tapestry would also create an alias "account/view", by stripping off the redundant "account" suffix. Either name is equally valid in your code, and Tapestry will use the shorter name, "account/view" in URLs.)</span></p><p>In addition, it is possible to define additional root packages for the application:</p><div class="code panel pdl" style="border-width: 1px;"><div class="codeContent panelContent pdl">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Templating and Markup FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+ <span class="title">Forms and Form Components FAQ</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><h2 id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And Component Classes</h2><p>Main article: <a shape="rect" href="component-classes.html">Component Classes</a></p><h3 id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's the difference between a page and a component?</h3><p>There's very little difference between the two. Pages classes must be in the <em>root-package</em>.<code>pages</code> package; components must be in the <em>root-package</em>.<code>components</code>. Pages may provide event handlers for certain page-specific events (such as activate and passivate). Components may have parameters.</p><p>Other than that, they are more equal than they are different. They may have templates or may render themselves in code (pages usually have a template, components are more likely to render only in code).</p><p>The major difference is that Tapestry page templates may be stored in the web context directory, as if they were static fi
les (they can't be accessed from the client however; a specific rule prevents access to files with the <code>.tml</code> extension).</p><div class="confluence-information-macro confluence-information-macro-warning"><span class="aui-icon aui-icon-small aui-iconfont-error confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>It is possible that this feature may be removed in a later release. It is preferred that page templates be stored on the classpath, like component templates.</p></div></div><h3 id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How do I store my page classes in a different package?</h3><p>Tapestry is very rigid here; you can't. Page classes must go in <em>root-package</em>.<code>pages</code>, component classes in <em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to create sub-packages, to help organize your code better and more logically. For example, you might have <em>root-pa
ckage</em>.<code>pages.account.ViewAccount</code>, which would have the page name "account/viewaccount". (<span style="line-height: 1.4285715;">Tapestry would also create an alias "account/view", by stripping off the redundant "account" suffix. Either name is equally valid in your code, and Tapestry will use the shorter name, "account/view" in URLs.)</span></p><p>In addition, it is possible to define additional root packages for the application:</p><div class="code panel pdl" style="border-width: 1px;"><div class="codeContent panelContent pdl">
<pre class="brush: java; gutter: true; theme: Default" style="font-size:12px;">public static void contributeComponentClassResolver(Configuration<LibraryMapping> configuration) {
configuration.add(new LibraryMapping("", "com.example.app.tasks"));
configuration.add(new LibraryMapping("", "com.example.app.chat"));
@@ -100,13 +123,13 @@ public class DBImage
-<span class="gliffy-container" id="gliffy-container-23527573-1598" data-fullwidth="750" data-ceoid="23335008" data-edit="${diagramEditLink.getLinkUrl()}" data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
+<span class="gliffy-container" id="gliffy-container-23527573-4485" data-fullwidth="750" data-ceoid="23335008" data-edit="${diagramEditLink.getLinkUrl()}" data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
- <map id="gliffy-map-23527573-5296" name="gliffy-map-23527573-5296"></map>
+ <map id="gliffy-map-23527573-7820" name="gliffy-map-23527573-7820"></map>
- <img class="gliffy-image" id="gliffy-image-23527573-1598" width="750" height="425" data-full-width="750" data-full-height="425" src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2" alt="Class Loaders" usemap="#gliffy-map-23527573-5296">
+ <img class="gliffy-image" id="gliffy-image-23527573-4485" width="750" height="425" data-full-width="750" data-full-height="425" src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2" alt="Class Loaders" usemap="#gliffy-map-23527573-7820">
- <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-1598" name="gliffy-dynamic-map-23527573-1598"></map>
+ <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-4485" name="gliffy-dynamic-map-23527573-4485"></map>
</span>
@@ -117,7 +140,30 @@ public class DBImage
. . .
}
</pre>
-</div></div><p>The compiler will catch a misspelling of the constant <code>SUCCESS</code>. Likewise, local constants can be defined for key components, such as "loginForm".</p><div class="confluence-information-macro confluence-information-macro-information"><span class="aui-icon aui-icon-small aui-iconfont-info confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>Ultimately, it's developer choice. HLS prefers the method naming conventions in nearly all cases, especially prototypes and demos, but can see that in some projects and some teams, an annotation-only approach is best.</p></div></div><h3 id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why do I have to inject a page? Why can't I just create one using new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large constructor for the class instance. Further, an instance of the class is useless by itself, it must be wired together wi
th its template and its sub-components.</p><p>On top of that, Tapestry keeps just once instance of each page in memory (since 5.2). It reworks the bytecode of the components so that a single instance can be shared across multiple request handling threads.</p><p>____</p><p> </p><p> </p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table class="Footnotes" style="width: 100%; border:none;" cellspacing="0" cellpadding="0" summary="This table contains one or more notes for references made elsewhere on the page."><caption class="accessibility">Footnotes</caption><thead class="accessibility"><tr class="accessibility"><th colspan="1" rowspan="1" class="accessibility" id="footnote-th1">Reference</th><th colspan="1" rowspan="1" class="accessibility" id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p> </p><p> </p></div>
+</div></div><p>The compiler will catch a misspelling of the constant <code>SUCCESS</code>. Likewise, local constants can be defined for key components, such as "loginForm".</p><div class="confluence-information-macro confluence-information-macro-information"><span class="aui-icon aui-icon-small aui-iconfont-info confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>Ultimately, it's developer choice. HLS prefers the method naming conventions in nearly all cases, especially prototypes and demos, but can see that in some projects and some teams, an annotation-only approach is best.</p></div></div><h3 id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why do I have to inject a page? Why can't I just create one using new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large constructor for the class instance. Further, an instance of the class is useless by itself, it must be wired together wi
th its template and its sub-components.</p><p>On top of that, Tapestry keeps just once instance of each page in memory (since 5.2). It reworks the bytecode of the components so that a single instance can be shared across multiple request handling threads.</p>
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Templating and Markup FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+ <span class="title">Forms and Form Components FAQ</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><p>____</p><p> </p><p> </p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table class="Footnotes" style="width: 100%; border:none;" cellspacing="0" cellpadding="0" summary="This table contains one or more notes for references made elsewhere on the page."><caption class="accessibility">Footnotes</caption><thead class="accessibility"><tr class="accessibility"><th colspan="1" rowspan="1" class="accessibility" id="footnote-th1">Reference</th><th colspan="1" rowspan="1" class="accessibility" id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p> </p><p> </p></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-50.html
==============================================================================
--- websites/production/tapestry/content/release-notes-50.html (original)
+++ websites/production/tapestry/content/release-notes-50.html Sun Nov 8 17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="how-to-upgrade.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">How to Upgrade</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-51.html" rel="next">
+ <span class="title">Release Notes 5.1</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.0.3 and 5.0.19. Before upgrading, be sure to review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340848275 {padding: 0px;}
-div.rbtoc1437340848275 ul {list-style: disc;margin-left: 0px;padding-left: 5px;}
-div.rbtoc1437340848275 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003262602 {padding: 0px;}
+div.rbtoc1447003262602 ul {list-style: disc;margin-left: 0px;padding-left: 5px;}
+div.rbtoc1447003262602 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340848275">
+/*]]>*/</style><div class="toc-macro rbtoc1447003262602">
<ul class="toc-indentation"><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.19">Tapestry Version 5.0.19</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.18">Tapestry Version 5.0.18</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.17">Tapestry Version 5.0.17</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.16">Tapestry Version 5.0.16</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.15">Tapestry Version 5.0.15</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.14">Tapestry Version 5.0.14</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.13">Tapestry Version 5.0.13</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.12">Tapestry Version 5.0.12</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.11">Tapestry Version 5.0.11</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.10">Tapestry Version 5.0.
10</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.9">Tapestry Version 5.0.9</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.8">Tapestry Version 5.0.8</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.7">Tapestry Version 5.0.7</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.6">Tapestry Version 5.0.6</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.5">Tapestry Version 5.0.5</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.4">Tapestry Version 5.0.4</a></li><li><a shape="rect" href="#ReleaseNotes5.0-TapestryVersion5.0.3">Tapestry Version 5.0.3</a></li></ul>
</div>
@@ -421,7 +444,31 @@ div.rbtoc1437340848275 li {margin-left:
<ul><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1276">TAPESTRY-1276</a> – If component should include an optional negate parameter</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1284">TAPESTRY-1284</a> – Tapestry Spring integration module</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1292">TAPESTRY-1292</a> – Allow lists to be used as select models</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1302">TAPESTRY-1302</a> – JavaScript support</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1311">TAPESTRY-1311</a> – Identify type of component via tag element name in templates</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1319">TAPESTRY-1319</a> –
tapestry.InfrastructureOverrides is not yet implemented</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1325">TAPESTRY-1325</a> – Add an "asset:" object provider, to simplfy injecting assets into services</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAPESTRY-1341">TAPESTRY-1341</a> – Allow service builders named "build" and determine service id from the result type</li></ul>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="how-to-upgrade.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">How to Upgrade</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-51.html" rel="next">
+ <span class="title">Release Notes 5.1</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-51.html
==============================================================================
--- websites/production/tapestry/content/release-notes-51.html (original)
+++ websites/production/tapestry/content/release-notes-51.html Sun Nov 8 17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-50.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.0</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-52.html" rel="next">
+ <span class="title">Release Notes 5.2</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.0 and 5.1. Before upgrading, be sure to review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340791870 {padding: 0px;}
-div.rbtoc1437340791870 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340791870 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003195363 {padding: 0px;}
+div.rbtoc1447003195363 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003195363 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340791870">
+/*]]>*/</style><div class="toc-macro rbtoc1447003195363">
<ul class="toc-indentation"><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.5">Tapestry Version 5.1.0.5</a></li><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.4">Tapestry Version 5.1.0.4</a></li><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.3">Tapestry Version 5.1.0.3</a></li><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.2">Tapestry Version 5.1.0.2</a></li><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.1">Tapestry Version 5.1.0.1</a></li><li><a shape="rect" href="#ReleaseNotes5.1-TapestryVersion5.1.0.0">Tapestry Version 5.1.0.0</a></li></ul>
</div>
@@ -207,7 +230,31 @@ div.rbtoc1437340791870 li {margin-left:
<ul><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-372">TAP5-372</a> – Merge changes from 5.0.16 --> 5.0.17 into trunk (5.1)</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-379">TAP5-379</a> – Add the Ars Machina Project to the list of Tapestry 5-related packages</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-381">TAP5-381</a> – Documentation talks about a "tapestry.charset" when there's no such configuration documented</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-480">TAP5-480</a> – Upgrade Surefire Plugin and TestNG dependencies to latest version (2.4.3 and 5.8, respectively)</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-493">TAP5-493</a> – Translate StructureStrings#original-child-component</li><li><a shape="rect"
class="external-link" href="https://issues.apache.org/jira/browse/TAP5-494">TAP5-494</a> – Downgrade maven-site-plugin from 2.0-beta-6 to 2.0-beta-5 because we prefer a site that actually works</li></ul>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-50.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.0</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-52.html" rel="next">
+ <span class="title">Release Notes 5.2</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-52.html
==============================================================================
--- websites/production/tapestry/content/release-notes-52.html (original)
+++ websites/production/tapestry/content/release-notes-52.html Sun Nov 8 17:21:51 2015
@@ -68,12 +68,35 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><p>This is the consolidated list of changes between Tapestry versions 5.1 and 5.2. To upgrade from 5.1 to 5.2, most users will be able to just update the Maven dependency in their POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please read carefully below before upgrading, and also review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p><p><strong>Contents</strong></p><p><style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340824369 {padding: 0px;}
-div.rbtoc1437340824369 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340824369 li {margin-left: 0px;padding-left: 0px;}
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-51.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-53.html" rel="next">
+ <span class="title">Release Notes 5.3</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><p>This is the consolidated list of changes between Tapestry versions 5.1 and 5.2. To upgrade from 5.1 to 5.2, most users will be able to just update the Maven dependency in their POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please read carefully below before upgrading, and also review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p><p><strong>Contents</strong></p><p><style type="text/css">/*<![CDATA[*/
+div.rbtoc1447003233865 {padding: 0px;}
+div.rbtoc1447003233865 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003233865 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style></p><div class="toc-macro rbtoc1437340824369">
+/*]]>*/</style></p><div class="toc-macro rbtoc1447003233865">
<ul class="toc-indentation"><li><a shape="rect" href="#ReleaseNotes5.2-BreakingChanges">Breaking Changes</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.6">Release Notes: Tapestry 5.2.6</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.5">Release Notes: Tapestry 5.2.5</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.4">Release Notes: Tapestry 5.2.4</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.3">Release Notes: Tapestry 5.2.3</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.2">Release Notes: Tapestry 5.2.2</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.1">Release Notes: Tapestry 5.2.1</a></li><li><a shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.0">Release Notes: Tapestry 5.2.0</a></li></ul>
</div><h2 id="ReleaseNotes5.2-BreakingChanges">Breaking Changes</h2><p>The following changes have been made in Tapestry 5.2 that are likely to result in unexpected behavior if your application relies on the changed functionality. Please review this list carefully before upgrading from 5.1 to 5.2. Also check the <a shape="rect" class="external-link" href="http://tapestry.apache.org/current/apidocs/deprecated-list.html">Deprecated API List</a> for non-breaking changes.</p><ul><li>Page classes with instance variables that are not thread safe must be created in a method rather than declared as an instance variable. For example, creating an instance variable <code>private final DateFormat format = DateFormat.getDateInstance(DateFormat.MEDIUM, locale);</code> in a page and using it will cause problems because DateFormat is not thread safe. Instead, you must create the DateFormat in a method. See <a shape="rect" href="release-notes-52.html">Release Notes: Tapestry 5.2.0</a> (below) for det
ails.</li><li><a shape="rect" class="external-link" href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/Link.html#toAbsoluteURI%28%29">Link.toAbsoluteURI()</a> now returns the absolute URL, which includes the scheme, hostname and possibly port (e.g., "http://example.com:8080/myapp/viewproduct/4"), rather than a relative URL (e.g., "/myapp/viewproduct/4"). See <a shape="rect" href="release-notes-52.html">Release Notes: Tapestry 5.2.2</a> (below) for details.</li><li>The <a shape="rect" class="external-link" href="http://tapestry.apache.org/tapestry5.2-dev/tapestry-core/ref/org/apache/tapestry5/corelib/components/Label.html">Label</a> component no longer outputs an id:</li></ul><p>Previously valid code in 5.1.0.5:</p><div class="code panel pdl" style="border-width: 1px;"><div class="codeContent panelContent pdl">
<pre class="brush: xml; gutter: false; theme: Default" style="font-size:12px;"><t:form><t:label for="search"/><t:textfield t:id="search" size="50"/></t:form></pre>
@@ -263,7 +286,30 @@ built-in translators. This will break ex
<h3 id="ReleaseNotes5.2-TasksCompleted.2">Tasks Completed</h3>
<ul><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-11">TAP5-11</a> – CookiesImplTest does specify a domain cookie with a domain not prefixed with a . (dot)</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-556">TAP5-556</a> – Fix TranslatorSourceImplTest</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-756">TAP5-756</a> – Add ioko-tapestry-commons to the related projects list</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-819">TAP5-819</a> – remove ide-specific files from all sub-modules and add them to svn:ignore</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-969">TAP5-969</a> – Method AbstractField.createDefaultParameterBinding() should be deprecated</li><li><a shape="rect" class="external-link" href="https://issues.apache.o
rg/jira/browse/TAP5-976">TAP5-976</a> – Upgrade Spring dependencies to version 3.0.0.RELEASE</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-1081">TAP5-1081</a> – Remove formos references from 5.2.0 archetype</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-1087">TAP5-1087</a> – Upgrade TestNG dependencies to version 5.12.1</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-1134">TAP5-1134</a> – Upgrade Hibernate dependencies to 3.5.2</li><li><a shape="rect" class="external-link" href="https://issues.apache.org/jira/browse/TAP5-1195">TAP5-1195</a> – Rename annotations @QueryParameter and @QueryParameterMapped (both introduced in 5.2.0) to more mnemonic names</li></ul>
-</div>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-51.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-53.html" rel="next">
+ <span class="title">Release Notes 5.3</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-53.html
==============================================================================
--- websites/production/tapestry/content/release-notes-53.html (original)
+++ websites/production/tapestry/content/release-notes-53.html Sun Nov 8 17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-52.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-531.html" rel="next">
+ <span class="title">Release Notes 5.3.1</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.2 and 5.3. To upgrade from 5.2 to 5.3, most users who are not using deprecated features will be able to just update the Maven dependency in their POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please read carefully below before upgrading, and also review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340812101 {padding: 0px;}
-div.rbtoc1437340812101 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340812101 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003219213 {padding: 0px;}
+div.rbtoc1447003219213 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003219213 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340812101">
+/*]]>*/</style><div class="toc-macro rbtoc1447003219213">
<ul class="toc-indentation"><li><a shape="rect" href="#ReleaseNotes5.3-BreakingChanges">Breaking Changes</a></li><li><a shape="rect" href="#ReleaseNotes5.3-NewFeatures">New Features</a></li><li><a shape="rect" href="#ReleaseNotes5.3-Sub-tasksCompleted">Sub-tasks Completed</a></li><li><a shape="rect" href="#ReleaseNotes5.3-BugsFixed">Bugs Fixed</a></li><li><a shape="rect" href="#ReleaseNotes5.3-ImprovementsMade">Improvements Made</a></li><li><a shape="rect" href="#ReleaseNotes5.3-NewFeaturesImplemented">New Features Implemented</a></li><li><a shape="rect" href="#ReleaseNotes5.3-TasksCompleted">Tasks Completed</a></li></ul>
</div>
@@ -501,7 +524,31 @@ div.rbtoc1437340812101 li {margin-left:
<p></p>
<p></p><p></p><p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-52.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-531.html" rel="next">
+ <span class="title">Release Notes 5.3.1</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-531.html
==============================================================================
--- websites/production/tapestry/content/release-notes-531.html (original)
+++ websites/production/tapestry/content/release-notes-531.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-53.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-532.html" rel="next">
+ <span class="title">Release Notes 5.3.2</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This bugfix release is a drop-in replacement for the <a shape="rect" href="release-notes-53.html">5.3</a> release. Any 5.3 user is encouraged to upgrade. Be sure to review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions first, though.</p>
@@ -93,7 +116,31 @@
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-53.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-532.html" rel="next">
+ <span class="title">Release Notes 5.3.2</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-532.html
==============================================================================
--- websites/production/tapestry/content/release-notes-532.html (original)
+++ websites/production/tapestry/content/release-notes-532.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-531.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-533.html" rel="next">
+ <span class="title">Release Notes 5.3.3</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.1 and 5.3.2. To upgrade, just update the Maven dependency in you POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. And be sure to check the <a shape="rect" href="release-notes-53.html">Release Notes for 5.3</a> and <a shape="rect" href="release-notes-531.html">Release Notes for 5.3.1</a> too.</p>
@@ -102,7 +125,31 @@
</li></ul>
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-531.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-533.html" rel="next">
+ <span class="title">Release Notes 5.3.3</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-533.html
==============================================================================
--- websites/production/tapestry/content/release-notes-533.html (original)
+++ websites/production/tapestry/content/release-notes-533.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-532.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-534.html" rel="next">
+ <span class="title">Release Notes 5.3.4</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.2 and 5.3.3. Tapestry 5.3.3 is a drop-in replacement for prior Tapestry 5.3 releases. To upgrade, just update the Maven dependency in you POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. </p>
@@ -98,7 +121,31 @@
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-532.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-534.html" rel="next">
+ <span class="title">Release Notes 5.3.4</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-534.html
==============================================================================
--- websites/production/tapestry/content/release-notes-534.html (original)
+++ websites/production/tapestry/content/release-notes-534.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-533.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-535.html" rel="next">
+ <span class="title">Release Notes 5.3.5</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.3 and 5.3.4. Tapestry 5.3.4 is a drop-in replacement for prior Tapestry 5.3 releases. To upgrade, just update the Maven dependency in you POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. </p>
@@ -98,7 +121,31 @@
</li></ul>
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-533.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-535.html" rel="next">
+ <span class="title">Release Notes 5.3.5</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-535.html
==============================================================================
--- websites/production/tapestry/content/release-notes-535.html (original)
+++ websites/production/tapestry/content/release-notes-535.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-534.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.4</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-536.html" rel="next">
+ <span class="title">Release Notes 5.3.6</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p>
<p>This is the consolidated list of changes between Tapestry included in version 5.3.5. Tapestry 5.3.5 is a drop-in replacement for prior Tapestry 5.3 releases. To upgrade, just update the Maven dependency in you POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. </p>
@@ -100,7 +123,31 @@
<ul><li>[<a shape="rect" href="https://issues.apache.org/jira/browse/TAP5-1989">TAP5-1989</a>] - Upgrade bundled Prototype to version 1.7.1
</li></ul>
- <p></p></div>
+ <p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-534.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.4</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-536.html" rel="next">
+ <span class="title">Release Notes 5.3.6</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-536.html
==============================================================================
--- websites/production/tapestry/content/release-notes-536.html (original)
+++ websites/production/tapestry/content/release-notes-536.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-535.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.5</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-537.html" rel="next">
+ <span class="title">Release Notes 5.3.7</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.5 and 5.3.6. Tapestry 5.3.6 is a drop-in replacement for prior Tapestry 5.3 releases. To upgrade, just update the Maven dependency in your POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. </p>
@@ -96,7 +119,31 @@
<ul><li>[<a shape="rect" href="https://issues.apache.org/jira/browse/TAP5-1996">TAP5-1996</a>] - Add Severity.SUCCESS enum for alerts
</li></ul>
- <p></p></div>
+ <p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-535.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.5</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-537.html" rel="next">
+ <span class="title">Release Notes 5.3.7</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-537.html
==============================================================================
--- websites/production/tapestry/content/release-notes-537.html (original)
+++ websites/production/tapestry/content/release-notes-537.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-536.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.6</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-54.html" rel="next">
+ <span class="title">Release Notes 5.4</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.6 and 5.3.7. Tapestry 5.3.7 is a drop-in replacement for prior Tapestry 5.3 releases. To upgrade, just update the Maven dependency in your POM file (or <a shape="rect" href="download.html">download</a> the new JAR file) and the new version will just work. However, please review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.</p>
@@ -109,7 +132,31 @@
<ul><li>[<a shape="rect" href="https://issues.apache.org/jira/browse/TAP5-2055">TAP5-2055</a>] - Polish translations
</li></ul>
-<p></p></div>
+<p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-536.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.6</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-54.html" rel="next">
+ <span class="title">Release Notes 5.4</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-54.html
==============================================================================
--- websites/production/tapestry/content/release-notes-54.html (original)
+++ websites/production/tapestry/content/release-notes-54.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-537.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.7</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-538.html" rel="next">
+ <span class="title">Release notes 5.3.8</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3 and 5.4. To upgrade to 5.4, most users who are not using deprecated features will be able to just update the dependency version in their Maven POM file or Gradle build script (or <a shape="rect" href="download.html">download</a> the new JAR files) and the new version will just work. However, please read carefully below before upgrading, and also review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
@@ -108,7 +131,31 @@
<p>Prior releases of Tapestry primarily organized client-side logic in terms of JavaScript libraries. These libraries can be declaratively imported into the page (either during a full-page render, or during an Ajax partial page update). In addition, libraries can be combined together into <em>stacks</em>, which (in a production application) are combined into a single virtual asset.</p>
<p>The library approach is <a shape="rect" href="javascript-rewrite-in-54.html">fundamentally limited in a number of ways</a>, including namespace pollution and dealing with dependencies between libraries. Tapestry 5.4 introduces a parallel mechanism, based on <a shape="rect" class="external-link" href="http://requirejs.org" >RequireJS</a> and the <a shape="rect" class="external-link" href="https://github.com/amdjs/amdjs-api/wiki/AMD" >Asynchronous Module Definition</a> as a way to speed up initial page load and organize client-side JavaScript in a more expressive and maintainable way.</p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-537.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.7</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-538.html" rel="next">
+ <span class="title">Release notes 5.3.8</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-upgrade-faq.html
==============================================================================
--- websites/production/tapestry/content/release-upgrade-faq.html (original)
+++ websites/production/tapestry/content/release-upgrade-faq.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,26 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="maven-support-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Maven Support FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+
+ </div>
+</div>
<h2 id="ReleaseUpgradeFAQ-ReleaseUpgradeFAQ">Release Upgrade FAQ </h2>
@@ -76,7 +95,27 @@
<h3 id="ReleaseUpgradeFAQ-WhydoIgetanexceptionaboutorg.apache.tapestry5.internal.services.RequestPathOptimizerafterupgradingto5.2?">Why do I get an exception about org.apache.tapestry5.internal.services.RequestPathOptimizer after upgrading to 5.2?</h3>
<p>Although Tapestry works very hard to keep backwards compatibility between releases for <em>public</em> APIs, all <em>internal</em> APIs are subject to change. This error is commonly due to the use of the ChenilleKit library, which makes use of some internal APIs. You must also upgrade your ChenilleKit dependency when moving from Tapestry 5.1 to 5.2 or later. See the <a shape="rect" class="external-link" href="http://tapestry.markmail.org/thread/3cj2wuvl4idnpmjr" >complete discussion of this from the Tapestry user mailing list</a>. </p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="maven-support-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Maven Support FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/request-processing-faq.html
==============================================================================
--- websites/production/tapestry/content/request-processing-faq.html (original)
+++ websites/production/tapestry/content/request-processing-faq.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="integration-with-existing-applications.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Integration with existing applications</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="limitations.html" rel="next">
+ <span class="title">Limitations</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<h2 id="RequestProcessingFAQ-RequestProcessing">Request Processing</h2>
@@ -90,7 +113,30 @@ public static void contributeIgnoredPath
<p>Alternately, you can configure the Tapestry application to execute inside a folder to avoid conflicts. See the notes on the <a shape="rect" href="configuration.html">configuration page</a>.</p>
- </div>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="integration-with-existing-applications.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Integration with existing applications</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="limitations.html" rel="next">
+ <span class="title">Limitations</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div> </div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/security-faq.html
==============================================================================
--- websites/production/tapestry/content/security-faq.html (original)
+++ websites/production/tapestry/content/security-faq.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><h2 id="SecurityFAQ-SecurityFAQ">Security FAQ</h2><p> </p><div class="aui-label" style="float:right" title="Related Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="tapestry-inversion-of-control-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Tapestry Inversion of Control FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="integration-with-existing-applications.html" rel="next">
+ <span class="title">Integration with existing applications</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><h2 id="SecurityFAQ-SecurityFAQ">Security FAQ</h2><p> </p><div class="aui-label" style="float:right" title="Related Articles">
@@ -113,7 +136,30 @@
if (productionMode) { configuration.override("LocalhostOnly", null); }
}
</pre>
-</div></div><p></p></div>
+</div></div><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="tapestry-inversion-of-control-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Tapestry Inversion of Control FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="integration-with-existing-applications.html" rel="next">
+ <span class="title">Integration with existing applications</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/session-storage.html
==============================================================================
--- websites/production/tapestry/content/session-storage.html (original)
+++ websites/production/tapestry/content/session-storage.html Sun Nov 8 17:21:51 2015
@@ -109,11 +109,11 @@
</div><p>Ordinary <a shape="rect" href="persistent-page-data.html">page-persistent fields</a> won't work for this, since persistent fields are available only to a specific page, not shared across multiple pages.</p><p>Tapestry provides two mechanisms for storing such data: Session State Objects and Session Attributes. When deciding between the two, it's best to use Session State Objects for complex objects, and Session Attributes for simple types.</p><h2 id="SessionStorage-SessionStateObjects">Session State Objects</h2><p>With a Session State Object (SSO), the value is automatically stored outside the page; with the default storage strategy, it is stored in the session. Such a value is global to all pages <em>for the same user</em>, but is stored separately for different users.</p><p>A field holding an SSO is marked with the @<a shape="rect" class="external-link" href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/annotations/SessionState.html">SessionState</a> ann
otation.</p><div class="navmenu" style="float:right; background:white; margin:3px; padding:3px">
<div class="panel" style="border-width: 1px;"><div class="panelHeader" style="border-bottom-width: 1px;"><b>Contents</b></div><div class="panelContent">
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437945582068 {padding: 0px;}
-div.rbtoc1437945582068 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437945582068 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003269495 {padding: 0px;}
+div.rbtoc1447003269495 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003269495 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437945582068">
+/*]]>*/</style><div class="toc-macro rbtoc1447003269495">
<ul class="toc-indentation"><li>Related Articles</li></ul>
<ul><li><a shape="rect" href="#SessionStorage-SessionStateObjects">Session State Objects</a>
<ul class="toc-indentation"><li><a shape="rect" href="#SessionStorage-Pitfalls">Pitfalls</a></li><li><a shape="rect" href="#SessionStorage-CheckforCreation">Check for Creation</a></li><li><a shape="rect" href="#SessionStorage-PersistenceStrategies">Persistence Strategies</a></li><li><a shape="rect" href="#SessionStorage-ConfiguringSSOs">Configuring SSOs</a></li></ul>
Modified: websites/production/tapestry/content/specific-errors-faq.html
==============================================================================
--- websites/production/tapestry/content/specific-errors-faq.html (original)
+++ websites/production/tapestry/content/specific-errors-faq.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><div class="aui-label" style="float:right" title="Related Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="limitations.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Limitations</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="hibernate-support-faq.html" rel="next">
+ <span class="title">Hibernate Support FAQ</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><div class="aui-label" style="float:right" title="Related Articles">
@@ -106,7 +129,30 @@
</div>
</li></ul>
-</div><h3 id="SpecificErrorsFAQ-WhydoIgettheexception"Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources"whentryingtousetheBeanEditFormcomponent?">Why do I get the exception "No service implements the interface org.apache.tapestry5.internal.InternalComponentResources" when trying to use the BeanEditForm component?</h3><p>This can occur when you choose the wrong package for your data object, the object edited by the BeanEditForm component. If you place it in the same package as your pages, Tapestry will treat it like a page, and perform a number of transformation on it, including adding a new constructor.</p><p>Only component classes should go in the Tapestry-controlled packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and <code>base</code> under your application's root package). By convention, simple data objects should go in a <code>data</code> package, and Hibernate entities should go in an <code>entities</cod
e> package.</p><div class="confluence-information-macro confluence-information-macro-note"><span class="aui-icon aui-icon-small aui-iconfont-warning confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>This is likely a bit different in 5.3 than in 5.2 (because 5.3 builds a very different constructor into the component) and needs to be tested in 5.3 to see what exact exception will occur.</p></div></div><h3 id="SpecificErrorsFAQ-Igetanerrorabout"Pagedidnotgenerateanymarkupwhenrendered."butIhaveatemplate,whathappened?">I get an error about "Page did not generate any markup when rendered." but I have a template, what happened?</h3><p>The most common error here is that the case of the page class did not match the case of the template. For example, you might name your class ViewOrders, but name the template vieworders.tml. The correct name for the template is ViewOrders.tml, matching the case of the Java class name.</p><p>Worse, you may fi
nd that your application works during development (under Windows, which is case insensitive) but does not work when deployed on a Linux or Unix server, which may be case sensitive.</p><p>The other cause of this may be that your template files simply are not being packaged up correctly with the rest of your application. When in doubt, use the Java <code>jar</code> command to see exactly whats inside your WAR file. Your page templates should either be in the root folder of the WAR, or package with the corresponding .class file.</p><h3 id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My application fails with the error <strong>PermGen</strong>, how do I fix this?</h3><p>PermGen refers to the part of the Java memory space devoted to permanent objects, which are mostly loaded classes. When developing under Tapestry, many more classes and class loaders are created than normal; this is part of live class reloading. Because of this, you will want to increase the a
mount of memory Java devotes to this.</p><p>The solution is to add <code>-XX:MaxPermSize=512m</code> to your command line. You may also want to increase the regular amount of heap space with <code>-Xmx600M</code>. Of course, you may need to adjust the amount of memory in each category to match your actual application, but these are good starting values.</p><p>Java Virtual Machine arguments can be specified inside an Eclipse launch configuration:</p><p><span class="confluence-embedded-file-wrapper"><img class="confluence-embedded-image confluence-thumbnail" src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3 id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after reloading my page?</h3><p>Tapestry's live class reloading is not perfect. <span style="line-height: 1.4285715;">It tends to use a lot of Java ClassLoaders on top of the normal Class
Loaders used by the Java Virtual Machine and the servlet container. When you change non-component classes and interfaces that are referenced by components and pages, such as to add or change a method, only the component classes are reloaded. The non-component classes are frozen as they were when they were </span><em style="line-height: 1.4285715;">first</em><span style="line-height: 1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where you must restart your application entirely in order to force the new versions of the non-component classes to be loaded into memory.</p><p> </p></div>
+</div><h3 id="SpecificErrorsFAQ-WhydoIgettheexception"Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources"whentryingtousetheBeanEditFormcomponent?">Why do I get the exception "No service implements the interface org.apache.tapestry5.internal.InternalComponentResources" when trying to use the BeanEditForm component?</h3><p>This can occur when you choose the wrong package for your data object, the object edited by the BeanEditForm component. If you place it in the same package as your pages, Tapestry will treat it like a page, and perform a number of transformation on it, including adding a new constructor.</p><p>Only component classes should go in the Tapestry-controlled packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and <code>base</code> under your application's root package). By convention, simple data objects should go in a <code>data</code> package, and Hibernate entities should go in an <code>entities</cod
e> package.</p><div class="confluence-information-macro confluence-information-macro-note"><span class="aui-icon aui-icon-small aui-iconfont-warning confluence-information-macro-icon"></span><div class="confluence-information-macro-body"><p>This is likely a bit different in 5.3 than in 5.2 (because 5.3 builds a very different constructor into the component) and needs to be tested in 5.3 to see what exact exception will occur.</p></div></div><h3 id="SpecificErrorsFAQ-Igetanerrorabout"Pagedidnotgenerateanymarkupwhenrendered."butIhaveatemplate,whathappened?">I get an error about "Page did not generate any markup when rendered." but I have a template, what happened?</h3><p>The most common error here is that the case of the page class did not match the case of the template. For example, you might name your class ViewOrders, but name the template vieworders.tml. The correct name for the template is ViewOrders.tml, matching the case of the Java class name.</p><p>Worse, you may fi
nd that your application works during development (under Windows, which is case insensitive) but does not work when deployed on a Linux or Unix server, which may be case sensitive.</p><p>The other cause of this may be that your template files simply are not being packaged up correctly with the rest of your application. When in doubt, use the Java <code>jar</code> command to see exactly whats inside your WAR file. Your page templates should either be in the root folder of the WAR, or package with the corresponding .class file.</p><h3 id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My application fails with the error <strong>PermGen</strong>, how do I fix this?</h3><p>PermGen refers to the part of the Java memory space devoted to permanent objects, which are mostly loaded classes. When developing under Tapestry, many more classes and class loaders are created than normal; this is part of live class reloading. Because of this, you will want to increase the a
mount of memory Java devotes to this.</p><p>The solution is to add <code>-XX:MaxPermSize=512m</code> to your command line. You may also want to increase the regular amount of heap space with <code>-Xmx600M</code>. Of course, you may need to adjust the amount of memory in each category to match your actual application, but these are good starting values.</p><p>Java Virtual Machine arguments can be specified inside an Eclipse launch configuration:</p><p><span class="confluence-embedded-file-wrapper"><img class="confluence-embedded-image confluence-thumbnail" src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3 id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after reloading my page?</h3><p>Tapestry's live class reloading is not perfect. <span style="line-height: 1.4285715;">It tends to use a lot of Java ClassLoaders on top of the normal Class
Loaders used by the Java Virtual Machine and the servlet container. When you change non-component classes and interfaces that are referenced by components and pages, such as to add or change a method, only the component classes are reloaded. The non-component classes are frozen as they were when they were </span><em style="line-height: 1.4285715;">first</em><span style="line-height: 1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where you must restart your application entirely in order to force the new versions of the non-component classes to be loaded into memory.</p><p> 
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="limitations.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Limitations</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="hibernate-support-faq.html" rel="next">
+ <span class="title">Hibernate Support FAQ</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/supporting-informal-parameters.html
==============================================================================
--- websites/production/tapestry/content/supporting-informal-parameters.html (original)
+++ websites/production/tapestry/content/supporting-informal-parameters.html Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><p><strong>Informal parameters</strong> are any additional parameters beyond the parameters explicitly defined for a component using the <a shape="rect" class="external-link" href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html">Parameter</a> annotation.</p><div class="aui-label" style="float:right" title="Related Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="error-page-recipe.html" rel="prev">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-left">Previous</span>
+ <span class="title">Error Page Recipe</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="cookbook.html" rel="parent">
+ <span class="aui-icon aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Cookbook</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="component-libraries.html" rel="next">
+ <span class="title">Component Libraries</span>
+ <span class="aui-icon aui-icon-small atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><strong>Informal parameters</strong> are any additional parameters beyond the parameters explicitly defined for a component using the <a shape="rect" class="external-link" href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html">Parameter</a> annotation.<div class="aui-label" style="float:right" title="Related Articles">